PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART07G22710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family CAMTA
Protein Properties Length: 1038aa    MW: 115682 Da    PI: 5.7341
Description CAMTA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART07G22710.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CG-1180.42.2e-56211372118
             CG-1   2 lkekkrwlkneeiaaiLenfekheltlelktrpksgsliLynrkkvryfrkDGyswkkkkdgktvrEdhekLKvggvevlycyYahseenptfq 95 
                      l+ ++rwl+++ei++iL n++k++++ e+++rp sgsl+L++rk++ryfrkDG++w+kkkdgktv+E+hekLKvg+v+vl+cyYah+een++fq
  OBART07G22710.1  21 LEAQNRWLRPTEICHILSNYKKFSIAPEPPNRPASGSLFLFDRKILRYFRKDGHNWRKKKDGKTVKEAHEKLKVGSVDVLHCYYAHGEENENFQ 114
                      5679****************************************************************************************** PP

             CG-1  96 rrcywlLeeelekivlvhylevk 118
                      rr+ywlLee + +ivlvhylevk
  OBART07G22710.1 115 RRTYWLLEEGFMNIVLVHYLEVK 137
                      ********************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5143781.09316142IPR005559CG-1 DNA-binding domain
SMARTSM010762.5E-7619137IPR005559CG-1 DNA-binding domain
PfamPF038593.4E-5022136IPR005559CG-1 DNA-binding domain
Gene3DG3DSA:2.60.40.106.6E-5442529IPR013783Immunoglobulin-like fold
SuperFamilySSF812961.71E-16443529IPR014756Immunoglobulin E-set
PfamPF018331.5E-4443516IPR002909IPT domain
SuperFamilySSF484031.71E-16630736IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.7E-17635737IPR020683Ankyrin repeat-containing domain
CDDcd002047.19E-13636734No hitNo description
PROSITE profilePS5029717.263642736IPR020683Ankyrin repeat-containing domain
PfamPF127964.4E-7648737IPR020683Ankyrin repeat-containing domain
SMARTSM002480.055675704IPR002110Ankyrin repeat
PROSITE profilePS500889.618675707IPR002110Ankyrin repeat
SMARTSM00248670714743IPR002110Ankyrin repeat
SMARTSM000154.2848870IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500968.718849878IPR000048IQ motif, EF-hand binding site
PfamPF006120.0056850869IPR000048IQ motif, EF-hand binding site
SuperFamilySSF525402.12E-7850899IPR027417P-loop containing nucleoside triphosphate hydrolase
SMARTSM000150.0096871893IPR000048IQ motif, EF-hand binding site
PROSITE profilePS500969.633872896IPR000048IQ motif, EF-hand binding site
PfamPF006122.4E-4874893IPR000048IQ motif, EF-hand binding site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0050826Biological Processresponse to freezing
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005516Molecular Functioncalmodulin binding
Sequence ? help Back to Top
Protein Sequence    Length: 1038 aa     Download sequence    Send to blast
MAEVRKYGLP NQPPDISQIL LEAQNRWLRP TEICHILSNY KKFSIAPEPP NRPASGSLFL  60
FDRKILRYFR KDGHNWRKKK DGKTVKEAHE KLKVGSVDVL HCYYAHGEEN ENFQRRTYWL  120
LEEGFMNIVL VHYLEVKGGK QSFSRSKEAE ESAGLSNADS PACSNSFASQ SQVASQSMDA  180
ESPISGQISE YEDAETEKFG ATDNCRASSR YHPFVEMQQP VDGVMMNNML GVSAPRYHGE  240
MQTTTANSDN HFATHYDIAG VFNEAGAGLR GVSKTLHDSV RFAEPYPECS AEFMEPALYS  300
SNATMESNNL DDNSRLETFM SEALYTNNLT QKEADALSAA GIMSSQAENN SYTDGIRYPL  360
LKQSSLDLFK IEPDGLKKFD SFSRWMSSEL PEVADLDIKS SSDAFWSSTE TVNVADGTSI  420
PINEQLDAFA VSPSLSQDQL FSIIDVSPSY ACTGSRNKVL ITGTFLANKE HVENCKWSCM  480
FGDVEVPAEV LAHGSLRCYT PVHLSGRVPF YVTCSNRVAC SEVREFEFRD SDARQMDTSD  540
PQTTGINEMH LHIRLEKLLS LGPDDYEKYV MSDGKEKSEI INTISSLMLD DKCLNQAVPL  600
DEKEVSTARD QNIEKLVKEK LYCWLVHKVH DEDKGPNVLG KEGQGVIHLV AALGYDWAVR  660
PIITAGVKVN FRDARGWTAL HWAASCGRER TVGALIANGA ESGLLTDPTP QFPAGRTAAD  720
LASENGHKGI AGFLAESALT SHLSALTLKE SKDGNVKEIC GLGGAEDFAE SSSAQLAYRD  780
SQAESLKDSL SAVRKSTQAA ARIFQAFRVE SFHRKKVVEY GDDDCGLSDE RTLSLVSIKN  840
AKPGQNDGSH SAAVRIQNKF RGWKGRKEFM IIRQKIVKIQ AHVRGHQVRK SYRRIVWSVG  900
IVEKIILRWR RKRRGLRGFQ PVKQLEGPSP IQQLEGPSQI QPAKEEEEDE YDYLKDGRKQ  960
AEGRLQRALA RVKSMTQYPE AREQYSRIAN RVTELQEPQA MMIQDDMQSD GAIADGGDFM  1020
AELEELCGDG DAPMPTIL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00501DAPTransfer from AT5G09410Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1084610.0AK108461.1 Oryza sativa Japonica Group cDNA clone:002-143-D08, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015647012.10.0PREDICTED: calmodulin-binding transcription activator 1 isoform X1
TrEMBLA0A0D3GTQ70.0A0A0D3GTQ7_9ORYZ; Uncharacterized protein
STRINGORGLA07G0175700.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60838140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G09410.10.0ethylene induced calmodulin binding protein